Foreword

This software is free and open-source software. If you use it, please support the project by citing it in publications:

Gatto L, Lilley KS. MSnbase-an R/Bioconductor package for isobaric tagged mass spectrometry data visualization, processing and quantitation. Bioinformatics. 2012 Jan 15;28(2):288-9. doi: 10.1093/bioinformatics/btr645. PMID: 22113085.

MSnbase, efficient and elegant R-based processing and visualisation of raw mass spectrometry data. Laurent Gatto, Sebastian Gibb, Johannes Rainer. bioRxiv 2020.04.29.067868; doi: https://doi.org/10.1101/2020.04.29.067868

Questions and bugs

For bugs, typos, suggestions or other questions, please file an issue in our tracking system (https://github.com/lgatto/MSnbase/issues) providing as much information as possible, a reproducible example and the output of sessionInfo().

If you don’t have a GitHub account or wish to reach a broader audience for general questions about proteomics analysis using R, you may want to use the Bioconductor support site: https://support.bioconductor.org/.

1 Introduction

MSnbase (Gatto and Lilley 2012) aims are providing a reproducible research framework to proteomics data analysis. It should allow researcher to easily mine mass spectrometry data, explore the data and its statistical properties and visually display these.

MSnbase also aims at being compatible with the infrastructure implemented in Bioconductor, in particular Biobase. As such, classes developed specifically for proteomics mass spectrometry data are based on the eSet and ExpressionSet classes. The main goal is to assure seamless compatibility with existing meta data structure, accessor methods and normalisation techniques.

This vignette illustrates MSnbase utility using a dummy data sets provided with the package without describing the underlying data structures. More details can be found in the package, classes, method and function documentations. A description of the classes is provided in the MSnbase-development vignette1 in R, open it with vignette("MSnbase-development") or read it online here.

1.1 Speed and memory requirements

Raw mass spectrometry file are generally several hundreds of MB large and most of this is used for binary raw spectrum data. As such, data containers can easily grow very large and thus require large amounts of RAM. This requirement is being tackled by avoiding to load the raw data into memory and using on-disk random access to the content of mzXML/mzML data files on demand. When focusing on reporter ion quantitation, a direct solution for this is to trim the spectra using the trimMz method to select the area of interest and thus substantially reduce the size of the Spectrum objects. This is illustrated in section 6.2.

Parallel processing The independent handling of spectra is ideally suited for parallel processing. The quantify method for example performs reporter peaks quantitation in parallel.

Parallel support is provided by the BiocParallel and various backends including multicore (forking, default on Linux), simple networf network of workstations (SNOW, default on Windows) using sockets, forking or MPI among others. We refer readers to the documentation in BiocParallel. Automatic parallel processing of spectra is only established for a certain number of spectra (per file). This value (default is 1000) can be set with the setMSnbaseParallelThresh function.

In sock-based parallel processing, the main worker process has to start new R instances and connect to them via sock. Sometimes these connections can not be established and the processes get stuck. To test this, users can disable parallel processing by disabling parallel processing with register(SerialParam()). To avoid these deadlocks, it is possible to initiate the parallel processing setup explicitly at the beginning of the script using, for example

library("doParallel")
registerDoParallel(3) ## using 3 slave nodes
register(DoparParam(), default = TRUE)

## rest of script comes below

On-disk access Developmenets in version 2 of the package have solved the memory issue by implementing and on-disk version the of data class storing raw data (MSnExp, see section 2.3), where the spectra a accessed on-disk only when required. The benchmarking vignette compares the on-disk and in-memory implemenatations2 in R, open it with vignette("benchmarking") or read it online here. See details below.

2 Data structure and content

2.1 Importing experiments

MSnbase is able to import raw MS data stored in one of the XML-based formats as well as peak lists in the mfg format3 Mascot Generic Format, see http://www.matrixscience.com/help/data_file_help.html#GEN.

Raw data The XML-based formats, mzXML (Pedrioli et al. 2004), mzData (Orchard et al. 2007) and mzML (Martens et al. 2010) can be imported with the readMSData function, as illustrated below (see ?readMSData for more details). To make use of the new on-disk implementation, set mode = "onDisk" in readMSData rather than using the default mode = "inMemory".

file <- dir(system.file(package = "MSnbase", dir = "extdata"),
            full.names = TRUE, pattern = "mzXML$")
rawdata <- readMSData(file, msLevel. = 2, verbose = FALSE)

Only spectra of a given MS level can be loaded at a time by setting the msLevel parameter accordingly in readMSData and in-memory data. In this document, we will use the itraqdata data set, provided with MSnbase. It includes feature metadata, accessible with the fData accessor. The metadata includes identification data for the 55 MS2 spectra.

Version 2.0 and later of MSnbase provide a new on-disk data storage model (see the benchmarking vignette for more details). The new data backend is compatible with the orignal in-memory model. To make use of the new infrastructure, read your raw data by setting the mode argument to "onDisk" (the default is still "inMemory" but is likely to change in the future). The new on-disk implementation supports several MS levels in a single raw data object. All existing operations work irrespective of the backend.

Peak lists can often be exported after spectrum processing from vendor-specific software and are also used as input to search engines. Peak lists in mgf format can be imported with the function readMgfData (see ?readMgfData for details) to create experiment objects. Experiments or individual spectra can be exported to an mgf file with the writeMgfData methods (see ?writeMgfData for details and examples).

Experiments with multiple runs Although it is possible to load and process multiple files serially and later merge the resulting quantitation data as show in section 13, it is also feasible to load several raw data files at once. Here, we report the analysis of an LC-MSMS experiment were 14 liquid chromatography (LC) fractions were loaded in memory using readMSData on a 32-cores servers with 128 Gb of RAM. It took about 90 minutes to read the 14 uncentroided mzXML raw files (4.9 Gb on disk in total) and create a 3.3 Gb raw data object (an MSnExp instance, see next section). Quantitation of 9 reporter ions (iTRAQ9 object, see 2.5) for 88690 features was performed in parallel on 16 processors and took 76 minutes. The resulting quantitation data was only 22.1 Mb and could easily be further processed. These number are based on the older in-memory implementation. As shown in the benchmarking vignette, using on-disk data greatly reduces memory requirement and computation time.

See also section 7.2 to import quantitative data stored in spreadsheets into R for further processing using MSnbase. The MSnbase-iovignette[in R, open it with vignette("MSnbase-io") or read it online here] gives a general overview of MSnbase’s input/ouput capabilites.

See section 7.3 for importing chromatographic data of SRM/MRM experiments.

2.2 Exporting experiments/MS data

MSnbase supports also to write MSnExp or OnDiskMSnExp objects to mzML or mzXML files using the writeMSData function. This is specifically useful in workflows in which the MS data was heavily manipulated. Presently, each sample/file is exported into one file.

Below we write the data in mzML format to a temporary file. By setting the optional parameter copy = TRUE general metadata (such as instrument info or all data processing descriptions) are copied over from the originating file.

writeMSData(rawdata, file = paste0(tempfile(), ".mzML"), copy = TRUE)

2.3 MS experiments

Raw data is contained in MSnExp objects, that stores all the spectra of an experiment, as defined by one or multiple raw data files.

library("MSnbase")
itraqdata
## MSn experiment data ("MSnExp")
## Object size in memory: 1.9 Mb
## - - - Spectra data - - -
##  MS level(s): 2 
##  Number of spectra: 55 
##  MSn retention times: 19:09 - 50:18 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011 
## Updated from version 0.3.0 to 0.3.1 [Fri Jul  8 20:23:25 2016] 
##  MSnbase version: 1.1.22 
## - - - Meta data  - - -
## phenoData
##   rowNames: 1
##   varLabels: sampleNames sampleNumbers
##   varMetadata: labelDescription
## Loaded from:
##   dummyiTRAQ.mzXML 
## protocolData: none
## featureData
##   featureNames: X1 X10 ... X9 (55 total)
##   fvarLabels: spectrum ProteinAccession ProteinDescription
##     PeptideSequence
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
head(fData(itraqdata))
##     spectrum ProteinAccession                       ProteinDescription
## X1         1              BSA                     bovine serum albumin
## X10       10          ECA1422 glucose-1-phosphate cytidylyltransferase
## X11       11          ECA4030         50S ribosomal subunit protein L4
## X12       12          ECA3882                   chaperone protein DnaK
## X13       13          ECA1364      succinyl-CoA synthetase alpha chain
## X14       14          ECA0871              NADP-dependent malic enzyme
##     PeptideSequence
## X1           NYQEAK
## X10 VTLVDTGEHSMTGGR
## X11           SPIWR
## X12        TAIDDALK
## X13          SILINK
## X14    DFEVVNNESDPR

As illustrated above, showing the experiment textually displays it’s content:

  • Information about the raw data, i.e. the spectra.

  • Specific information about the experiment processing4 This part will be automatically updated when the object is modified with it’s ad hoc methods, as illustrated later. and package version. This slot can be accessed with the processingData method.

  • Other meta data, including experimental phenotype, file name(s) used to import the data, protocol data, information about features (individual spectra here) and experiment data. Most of these are implemented as in the eSet class and are described in more details in their respective manual pages. See ?MSnExp and references therein for additional background information.

    The experiment meta data associated with an MSnExp experiment is of class MIAPE. It stores general information about the experiment as well as MIAPE (Minimum Information About a Proteomics Experiment) information Taylor et al. (2008). This meta-data can be accessed with the experimentData method. When available, a summary of MIAPE-MS data can be printed with the msInfo method. See ?MIAPE for more details.

2.4 Spectra objects

The raw data is composed of the 55 MS spectra. The spectra are named individually (X1, X10, X11, X12, X13, X14, …) and stored in a environment. They can be accessed individually with itraqdata[["X1"]] or itraqdata[[1]], or as a list with spectra(itraqdata). As we have loaded our experiment specifying msLevel=2, the spectra will all be of level 2 (or higher, if available).

sp <- itraqdata[["X1"]]
sp
## Object of class "Spectrum2"
##  Precursor: 520.7833 
##  Retention time: 19:09 
##  Charge: 2 
##  MSn level: 2 
##  Peaks count: 1922 
##  Total ion count: 26413754

Attributes of individual spectra or of all spectra of an experiment can be accessed with their respective methods: precursorCharge for the precursor charge, rtime for the retention time, mz for the MZ values, intensity for the intensities, … see the Spectrum, Spectrum1 and Spectrum2 manuals for more details.

peaksCount(sp)
## [1] 1922
head(peaksCount(itraqdata))
##   X1  X10  X11  X12  X13  X14 
## 1922 1376 1571 2397 2574 1829
rtime(sp)
## [1] 1149.31
head(rtime(itraqdata))
##      X1     X10     X11     X12     X13     X14 
## 1149.31 1503.03 1663.61 1663.86 1664.08 1664.32

2.5 Reporter ions

Reporter ions are defined with the ReporterIons class. Specific peaks of interest are defined by a MZ value, a with around the expected MZ and a name (and optionally a colour for plotting, see section 3). ReporterIons instances are required to quantify reporter peaks in MSnExp experiments. Instances for the most commonly used isobaric tags like iTRAQ 4-plex and 8-plex and TMT 6- and 10-plex tags are already defined in MSnbase. See ?ReporterIons for details about how to generate new ReporterIons objects.

iTRAQ4
## Object of class "ReporterIons"
## iTRAQ4: '4-plex iTRAQ' with 4 reporter ions
##  - [iTRAQ4.114] 114.1112 +/- 0.05 (red)
##  - [iTRAQ4.115] 115.1083 +/- 0.05 (green)
##  - [iTRAQ4.116] 116.1116 +/- 0.05 (blue)
##  - [iTRAQ4.117] 117.115 +/- 0.05 (yellow)
TMT16
## Object of class "ReporterIons"
## TMT16HCD: '16-plex TMT HCD' with 16 reporter ions
##  - [126] 126.1277 +/- 0.002 (#E55400)
##  - [127N] 127.1248 +/- 0.002 (#E28100)
##  - [127C] 127.1311 +/- 0.002 (#DFAC00)
##  - [128N] 128.1281 +/- 0.002 (#DDD700)
##  - [128C] 128.1344 +/- 0.002 (#B5DA00)
##  - [129N] 129.1315 +/- 0.002 (#87D8000)
##  - [129C] 129.1378 +/- 0.002 (#5BD500)
##  - [130N] 130.1348 +/- 0.002 (#30D300)
##  - [130C] 130.1411 +/- 0.002 (#05D000)
##  - [131N] 131.1382 +/- 0.002 (#00CE23)
##  - [131C] 131.1445 +/- 0.002 (#00CB4B)
##  - [132N] 132.1415 +/- 0.002 (#00C972)
##  - [132C] 132.1479 +/- 0.002 (#00C699)
##  - [133N] 133.1449 +/- 0.002 (#00C4BE)
##  - [133C] 133.1512 +/- 0.002 (#00A0C1)
##  - [134N] 134.1482 +/- 0.002 (#0078BF)

2.6 Chromatogram objects

Chromatographic data, i.e. intensity values along the retention time dimension for a given \(m/z\) range/slice, can be extracted with the chromatogram method. Below we read a file from the msdata package and extract the (MS level 1) chromatogram. Without providing an \(m/z\) and a retention time range the function returns the total ion chromatogram (TIC) for each file within the MSnExp or OnDiskMSnExp object. See also section 7.3 for importing chromatographic data from SRM/MRM experiments.

f <- c(system.file("microtofq/MM14.mzML", package = "msdata"))
mtof <- readMSData(f, mode = "onDisk")
mtof_tic <- chromatogram(mtof)
mtof_tic
## MChromatograms with 1 row and 1 column
##           MM14.mzML
##      <Chromatogram>
## [1,]    length: 112
## phenoData with 1 variables
## featureData with 1 variables

Chromatographic data, represented by the intensity-retention time duplets, is stored in the Chromatogram object. The chromatogram method returns a Chromatograms object (note the s) which holds multiple Chromatogram objects and arranges them in a two-dimensional grid with columns representing files/samples of the MSnExp or OnDiskMSnExp object and rows \(m/z\)-retention time ranges. In the example above the Chromatograms object contains only a single Chromatogram object. Below we access this chromatogram object. Similar to the Spectrum objects, Chromatogram objects provide the accessor functions intensity and rtime to access the data, as well as the mz function, that returns the \(m/z\) range of the chromatogram.

mtof_tic[1, 1]
## Object of class: Chromatogram
## Intensity values aggregated using: sum 
## length of object: 112
## from file: 1
## mz range: [94.80679, 1004.962]
## rt range: [270.334, 307.678]
## MS level: 1
head(intensity(mtof_tic[1, 1]))
## F1.S001 F1.S002 F1.S003 F1.S004 F1.S005 F1.S006 
##   64989   67445   77843  105097  155609  212760
head(rtime(mtof_tic[1, 1]))
## F1.S001 F1.S002 F1.S003 F1.S004 F1.S005 F1.S006 
## 270.334 270.671 271.007 271.343 271.680 272.016
mz(mtof_tic[1, 1])
## [1]   94.80679 1004.96155

To extract the base peak chromatogram (the largest peak along the \(m/z\) dimension for each retention time/spectrum) we set the aggregationFun argument to "max".

mtof_bpc <- chromatogram(mtof, aggregationFun = "max")

See the Chromatogram help page and the vignettes from the xcms package for more details and use cases, also on how to extract chromatograms for specific ions.

3 Plotting raw data

3.1 MS data space

The MSmap class can be used to isolate specific slices of interest from a complete MS acquisition by specifying \(m/z\) and retention time ranges. One needs a raw data file in a format supported by mzR’s openMSfile (mzML, mzXML, …). Below we first download a raw data file from the PRIDE repository and create an MSmap containing all the MS1 spectra between acquired between 30 and 35 minutes and peaks between 521 and 523 \(m/z\). See ?MSmap for details.

## downloads the data
library("rpx")
px1 <- PXDataset("PXD000001")
mzf <- pxget(px1, 7)

## reads the data
ms <- openMSfile(mzf)
hd <- header(ms)

## a set of spectra of interest: MS1 spectra eluted
## between 30 and 35 minutes retention time
ms1 <- which(hd$msLevel == 1)
rtsel <- hd$retentionTime[ms1] / 60 > 30 &
    hd$retentionTime[ms1] / 60 < 35

## the map
M <- MSmap(ms, ms1[rtsel], 521, 523, .005, hd, zeroIsNA = TRUE)
M
## Object of class "MSmap"
##  Map [75, 401]
##   [1]  Retention time: 30:01 - 34:58 
##   [2]  M/Z: 521 - 523 (res 0.005)

The M map object can be rendered as a heatmap with plot, as shown on figure 1.

plot(M, aspect = 1, allTicks = FALSE)
Heat map of a chunk of the MS data.

Figure 1: Heat map of a chunk of the MS data

One can also render the data in 3 dimension with the plot3D function, as show on figure 2.

plot3D(M)
3 dimensional represention of MS map data.

Figure 2: 3 dimensional represention of MS map data

To produce figure 3, we create a second MSmap object containing the first two MS1 spectra of the first map (object M above) and all intermediate MS2 spectra and display \(m/z\) values between 100 and 1000.

i <- ms1[which(rtsel)][1]
j <- ms1[which(rtsel)][2]
M2 <- MSmap(ms, i:j, 100, 1000, 1, hd)
M2
## Object of class "MSmap"
##  Map [12, 901]
##   [1]  Retention time: 30:01 - 30:05 
##   [2]  M/Z: 100 - 1000 (res 1)
plot3D(M2)
3 dimensional represention of MS map data. MS1 and MS2 spectra are coloured in blue and magenta respectively.

Figure 3: 3 dimensional represention of MS map data
MS1 and MS2 spectra are coloured in blue and magenta respectively.

3.2 MS Spectra

Spectra can be plotted individually or as part of (subset) experiments with the plot method. Full spectra can be plotted (using full=TRUE), specific reporter ions of interest (by specifying with reporters with reporters=iTRAQ4 for instance) or both (see figure 4).

plot(sp, reporters = iTRAQ4, full = TRUE)
Raw MS2 spectrum with details about reporter ions.

Figure 4: Raw MS2 spectrum with details about reporter ions

It is also possible to plot all spectra of an experiment (figure 5). Lets start by subsetting the itraqdata experiment using the protein accession numbers included in the feature metadata, and keep the 6 from the BSA protein.

sel <- fData(itraqdata)$ProteinAccession == "BSA"
bsa <- itraqdata[sel]
bsa
## MSn experiment data ("MSnExp")
## Object size in memory: 0.11 Mb
## - - - Spectra data - - -
##  MS level(s): 2 
##  Number of spectra: 3 
##  MSn retention times: 19:09 - 36:17 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011 
## Updated from version 0.3.0 to 0.3.1 [Fri Jul  8 20:23:25 2016] 
## Data [logically] subsetted 3 spectra: Mon May 18 18:48:14 2026 
##  MSnbase version: 1.1.22 
## - - - Meta data  - - -
## phenoData
##   rowNames: 1
##   varLabels: sampleNames sampleNumbers
##   varMetadata: labelDescription
## Loaded from:
##   dummyiTRAQ.mzXML 
## protocolData: none
## featureData
##   featureNames: X1 X52 X53
##   fvarLabels: spectrum ProteinAccession ProteinDescription
##     PeptideSequence
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
as.character(fData(bsa)$ProteinAccession)
## [1] "BSA" "BSA" "BSA"

These can then be visualised together by plotting the MSnExp object, as illustrated on figure 5.

plot(bsa, reporters = iTRAQ4, full = FALSE) + theme_gray(8)
Experiment-wide raw MS2 spectra. The y-axes of the individual spectra are automatically rescaled to the same range. See section \@ref(sec:norm) to rescale peaks identically.

Figure 5: Experiment-wide raw MS2 spectra
The y-axes of the individual spectra are automatically rescaled to the same range. See section 8.2 to rescale peaks identically.

Customising your plots The MSnbase plot methods have a logical plot parameter (default is TRUE), that specifies if the plot should be printed to the current device. A plot object is also (invisibly) returned, so that it can be saved as a variable for later use or for customisation.

MSnbase uses the package to generate plots, which can subsequently easily be customised. More details about can be found in (Wickham 2009) (especially chapter 8) and on http://had.co.nz/ggplot2/. Finally, if a plot object has been saved in a variable p, it is possible to obtain a summary of the object with summary(p). To view the data frame used to generate the plot, use p$data.

3.3 MS Chromatogram

Chromatographic data can be plotted using the plot method which, in contrast to the plot method for Spectrum classes, uses R base graphics. The plot method is implemented for Chromatogram and MChromatograms classes. The latter plots all chromatograms for the same \(m/z\)-rt range of all files in an experiment (i.e. for one row in the MChromatograms object) into one plot.

plot(mtof_bpc)
Base peak chromatogram.

Figure 6: Base peak chromatogram

4 Tandem MS identification data

Typically, identification data is produced by a search engine and serialised to disk in the mzIdentML (or mzid) file format. This format can be parsed by openIDfile from the mzR package or mzID from the mzID package. The MSnbase package relies on the former (which is faster) and offers a simplified interface by converting the dedicated identification data objects into data.frames.

library("MsDataHub")
idf <- MsDataHub::TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.20141210.mzid()
## see ?MsDataHub and browseVignettes('MsDataHub') for documentation
## loading from cache
iddf <- readMzIdData(idf)
str(iddf)
## 'data.frame':    5802 obs. of  35 variables:
##  $ sequence                : chr  "RQCRTDFLNYLR" "ESVALADQVTCVDWRNRKATKK" "KELLCLAMQIIR" "QRMARTSDKQQSIRFLERLCGR" ...
##  $ spectrumID              : chr  "controllerType=0 controllerNumber=1 scan=2949" "controllerType=0 controllerNumber=1 scan=6534" "controllerType=0 controllerNumber=1 scan=5674" "controllerType=0 controllerNumber=1 scan=4782" ...
##  $ chargeState             : int  3 2 2 3 3 3 2 3 3 2 ...
##  $ rank                    : int  1 1 1 1 1 1 1 1 1 1 ...
##  $ passThreshold           : logi  TRUE TRUE TRUE TRUE TRUE TRUE ...
##  $ experimentalMassToCharge: num  548 1288 744 913 927 ...
##  $ calculatedMassToCharge  : num  548 1288 744 913 926 ...
##  $ peptideRef              : chr  "Pep77" "Pep108" "Pep136" "Pep163" ...
##  $ modNum                  : int  1 1 1 1 1 1 1 2 2 1 ...
##  $ isDecoy                 : logi  FALSE FALSE TRUE FALSE TRUE FALSE ...
##  $ post                    : chr  "V" "G" "Q" "D" ...
##  $ pre                     : chr  "R" "R" "R" "R" ...
##  $ start                   : int  574 69 131 182 135 310 182 201 201 121 ...
##  $ end                     : int  585 90 142 203 158 334 203 233 233 140 ...
##  $ DatabaseAccess          : chr  "ECA2006" "ECA1676" "XXX_ECA2855" "ECA3009" ...
##  $ DBseqLength             : int  1295 110 157 437 501 477 437 1204 1204 210 ...
##  $ DatabaseSeq             : chr  "" "" "" "" ...
##  $ DatabaseDescription     : chr  "ECA2006 ATP-dependent helicase" "ECA1676 putative growth inhibitory protein" "" "ECA3009 putative coproporphyrinogen oxidase" ...
##  $ scan.number.s.          : num  2949 6534 5674 4782 5839 ...
##  $ acquisitionNum          : num  2949 6534 5674 4782 5839 ...
##  $ spectrumFile            : chr  "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" ...
##  $ idFile                  : chr  "eb443fd3662d_7857" "eb443fd3662d_7857" "eb443fd3662d_7857" "eb443fd3662d_7857" ...
##  $ MS.GF.RawScore          : num  10 12 8 -5 8 7 21 -31 -31 -3 ...
##  $ MS.GF.DeNovoScore       : num  101 121 74 160 241 214 196 165 165 59 ...
##  $ MS.GF.SpecEValue        : num  4.62e-08 7.26e-08 9.34e-08 1.27e-07 1.32e-07 ...
##  $ MS.GF.EValue            : num  0.132 0.209 0.267 0.366 0.379 ...
##  $ MS.GF.QValue            : num  0.525 0.61 0.625 0.717 0.736 ...
##  $ MS.GF.PepQValue         : num  0.549 0.623 0.636 0.724 0.745 ...
##  $ modPeptideRef           : chr  "Pep77" "Pep108" "Pep136" "Pep163" ...
##  $ modName                 : chr  "Carbamidomethyl" "Carbamidomethyl" "Carbamidomethyl" "Carbamidomethyl" ...
##  $ modMass                 : num  57 57 57 57 57 ...
##  $ modLocation             : int  3 11 5 20 20 21 20 1 28 4 ...
##  $ subOriginalResidue      : chr  NA NA NA NA ...
##  $ subReplacementResidue   : chr  NA NA NA NA ...
##  $ subLocation             : int  NA NA NA NA NA NA NA NA NA NA ...

The spectra along the rows are duplicated when the PSM can be assigned to multiple proteins, such as

##                                         spectrumID    sequence DatabaseAccess
## 3794 controllerType=0 controllerNumber=1 scan=5291  RKAYLLRMRR    XXX_ECA2052
## 4886 controllerType=0 controllerNumber=1 scan=5291 ILLHPLRTLMR        ECA1281

of when there are multiple modifications in a PSM, such as

##                                        spectrumID
## 411 controllerType=0 controllerNumber=1 scan=4936
## 412 controllerType=0 controllerNumber=1 scan=4936
##                                    sequence         modName modLocation
## 411 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK Carbamidomethyl           2
## 412 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK Carbamidomethyl          23

At this stage, it is useful to perform some exploratory data analysis and visualisation on the identification data. For example

table(iddf$isDecoy)
## 
## FALSE  TRUE 
##  2906  2896
table(iddf$chargeState)
## 
##    2    3    4    5    6 
## 3312 2064  400   23    3
library("ggplot2")
ggplot(data = iddf, aes(x = MS.GF.RawScore, colour = isDecoy)) +
    geom_density() +
    facet_wrap(~chargeState)

The filterIdentificationDataFrame function can be used to remove - PSMs that match decoy entries - PSMs of rank > 1 - PSMs that match non-proteotypic proteins

iddf <- filterIdentificationDataFrame(iddf)

This data.frame can be now be further reduced so that individual rows represent unique spectra, which can be done with the reduce method.

iddf2 <- reduce(iddf, key = "spectrumID")

This reduces the number of rows from 2710 to 2646.

The first duplicated spectrum mentioned above is now unique as is matched a decoy protein that was filtered out with filterIdentificationDataFrame.

##                                         spectrumID    sequence DatabaseAccess
## 1808 controllerType=0 controllerNumber=1 scan=5291 ILLHPLRTLMR        ECA1281

The matches to multiple modification in the same peptide are now combined into a single row and documented as semicolon-separated values.

##                                         spectrumID
## 1659 controllerType=0 controllerNumber=1 scan=4936
##                                                                             sequence
## 1659 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK;ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK
##                              modName modLocation
## 1659 Carbamidomethyl;Carbamidomethyl        2;23

This is the form that is used when combined to raw data, as described in the next section.

4.1 Adding identification data

MSnbase is able to integrate identification data from mzIdentML (Jones et al. 2012) files.

We first load two example files shipped with the MSnbase containing raw data (as above) and the corresponding identification results respectively. The raw data is read with the readMSData, as demonstrated above. As can be seen, the default feature data only contain spectra numbers. More data about the spectra is of course available in an MSnExp object, as illustrated in the previous sections. See also ?pSet and ?MSnExp for more details.

## find path to a mzXML file
quantFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
                 full.names = TRUE, pattern = "mzXML$")
## find path to a mzIdentML file
identFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
                 full.names = TRUE, pattern = "dummyiTRAQ.mzid")
## create basic MSnExp
msexp <- readMSData(quantFile, verbose = FALSE)
head(fData(msexp), n = 2)
##       spectrum
## F1.S1        1
## F1.S2        2

The addIdentificationData method takes an MSnExp instance (or an MSnSet instance storing quantitation data, see section 7.1) as first argument and one or multiple mzIdentML file names (as a character vector) as second one5 The identification data can also be passed as dedicated identification objects such as mzRident from the mzR package or mzID from thr mzID package, or as a data.frame - see ?addIdentifionData for details. and updates the MSnExp feature data using the identification data read from the mzIdentML file(s).

msexp <- addIdentificationData(msexp, id = identFile)
head(fData(msexp), n = 2)
##       spectrum acquisition.number          sequence chargeState rank
## F1.S1        1                  1 VESITARHGEVLQLRPK           3    1
## F1.S2        2                  2     IDGQWVTHQWLKK           3    1
##       passThreshold experimentalMassToCharge calculatedMassToCharge peptideRef
## F1.S1          TRUE                 645.3741               645.0375       Pep2
## F1.S2          TRUE                 546.9586               546.9633       Pep1
##       modNum isDecoy post pre start end DatabaseAccess DBseqLength DatabaseSeq
## F1.S1      0   FALSE    A   R   170 186        ECA0984         231            
## F1.S2      0   FALSE    A   K    50  62        ECA1028         275            
##                                                              DatabaseDescription
## F1.S1                                        ECA0984 DNA mismatch repair protein
## F1.S2 ECA1028 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
##       scan.number.s.          idFile MS.GF.RawScore MS.GF.DeNovoScore
## F1.S1              1 dummyiTRAQ.mzid            -39                77
## F1.S2              2 dummyiTRAQ.mzid            -30                39
##       MS.GF.SpecEValue MS.GF.EValue modPeptideRef modName modMass modLocation
## F1.S1     5.527468e-05     79.36958          <NA>    <NA>      NA          NA
## F1.S2     9.399048e-06     13.46615          <NA>    <NA>      NA          NA
##       subOriginalResidue subReplacementResidue subLocation nprot npep.prot
## F1.S1               <NA>                  <NA>          NA     1         1
## F1.S2               <NA>                  <NA>          NA     1         1
##       npsm.prot npsm.pep
## F1.S1         1        1
## F1.S2         1        1

Finally we can use idSummary to summarise the percentage of identified features per quantitation/identification pairs.

idSummary(msexp)
##       spectrumFile          idFile coverage
## 1 dummyiTRAQ.mzXML dummyiTRAQ.mzid      0.6

When identification data is present, and hence peptide sequences, one can annotation fragment peaks on the MS2 figure by passing the peptide sequence to the plot method.

itraqdata2 <- pickPeaks(itraqdata, verbose=FALSE)
i <- 14
s <- as.character(fData(itraqdata2)[i, "PeptideSequence"])
plot(itraqdata2[[i]], s, main = s)
Annotated MS2 spectrum.

Figure 7: Annotated MS2 spectrum

The fragment ions are calculated with the calculateFragments, described in section 4.3.

4.2 Filtering identification data

One can remove the features that have not been identified using removeNoId. This function uses by default the pepseq feature variable to search the presence of missing data (NA values) and then filter these non-identified spectra.

fData(msexp)$sequence
## [1] "VESITARHGEVLQLRPK" "IDGQWVTHQWLKK"     NA                 
## [4] NA                  "LVILLFR"
msexp <- removeNoId(msexp)
fData(msexp)$sequence
## [1] "VESITARHGEVLQLRPK" "IDGQWVTHQWLKK"     "LVILLFR"
idSummary(msexp)
##       spectrumFile          idFile coverage
## 1 dummyiTRAQ.mzXML dummyiTRAQ.mzid        1

Similarly, the removeMultipleAssignment method can be used to filter out non-unique features, i.e. that have been assigned to protein groups with more than one member. This function uses by default the nprot feature variable.

Note that removeNoId and removeMultipleAssignment methods can also be called on MSnExp instances.

4.3 Calculate Fragments

MSnbase is able to calculate theoretical peptide fragments via calculateFragments.

calculateFragments("ACEK",
                   type = c("a", "b", "c", "x", "y", "z"))
## Fixed modifications used: C=57.02146
## Variable modifications used: None
##           mz ion type pos z seq         peptide
## 1   44.04947  a1    a   1 1   A AC[+57.02146]EK
## 2  204.08012  a2    a   2 1  AC AC[+57.02146]EK
## 3  333.12271  a3    a   3 1 ACE AC[+57.02146]EK
## 4   72.04439  b1    b   1 1   A AC[+57.02146]EK
## 5  232.07504  b2    b   2 1  AC AC[+57.02146]EK
## 6  361.11763  b3    b   3 1 ACE AC[+57.02146]EK
## 7   89.07094  c1    c   1 1   A AC[+57.02146]EK
## 8  249.10158  c2    c   2 1  AC AC[+57.02146]EK
## 9  378.14417  c3    c   3 1 ACE AC[+57.02146]EK
## 10 173.09207  x1    x   1 1   K AC[+57.02146]EK
## 11 302.13466  x2    x   2 1  EK AC[+57.02146]EK
## 12 462.16531  x3    x   3 1 CEK AC[+57.02146]EK
## 13 147.11280  y1    y   1 1   K AC[+57.02146]EK
## 14 276.15539  y2    y   2 1  EK AC[+57.02146]EK
## 15 436.18604  y3    y   3 1 CEK AC[+57.02146]EK
## 16 130.08625  z1    z   1 1   K AC[+57.02146]EK
## 17 259.12884  z2    z   2 1  EK AC[+57.02146]EK
## 18 419.15949  z3    z   3 1 CEK AC[+57.02146]EK
## 19 284.12409 x2_   x_   2 1  EK AC[+57.02146]EK
## 20 258.14483 y2_   y_   2 1  EK AC[+57.02146]EK
## 21 241.11828 z2_   z_   2 1  EK AC[+57.02146]EK
## 22 155.08150 x1_   x_   1 1   K AC[+57.02146]EK
## 23 444.15474 x3_   x_   3 1 CEK AC[+57.02146]EK
## 24 129.10224 y1_   y_   1 1   K AC[+57.02146]EK
## 25 418.17548 y3_   y_   3 1 CEK AC[+57.02146]EK
## 26 112.07569 z1_   z_   1 1   K AC[+57.02146]EK
## 27 401.14893 z3_   z_   3 1 CEK AC[+57.02146]EK

It is also possible to match these fragments against an Spectrum2 object.

pepseq <- fData(msexp)$sequence[1]
calculateFragments(pepseq, msexp[[1]], type=c("b", "y"))
## Fixed modifications used: C=57.02146
## Variable modifications used: None
##           mz  intensity  ion type pos z             seq       error
## 1   100.0005       0.00   b1    b   1 1               V  0.07522824
## 2   429.2563 1972344.00   b4    b   4 1            VESI -0.02189010
## 3   512.3044  684918.00  b5_   b_   5 1           VESIT -0.03290132
## 4   513.3047 2574137.00   y4    y   4 1            LRPK  0.04598246
## 5   583.3300 1440833.75  b6_   b_   6 1          VESITA -0.02142609
## 6   754.4504  537234.81   y6    y   6 1          LQLRPK  0.04293155
## 7   836.6139   82364.42  y7*   y*   7 1         VLQLRPK -0.07865960
## 8   982.5354  500159.06   y8    y   8 1        EVLQLRPK  0.06897061
## 9  1080.5867  209363.69  b10    b  10 1      VESITARHGE -0.04344392
## 10 1672.8380   76075.02 b15*   b*  15 1 VESITARHGEVLQLR  0.07488430
## 11 1688.0375  136748.83 y15*   y*  15 1 SITARHGEVLQLRPK -0.07729359

5 Quality control

The current section is not executed dynamically for package size and processing time constrains. The figures and tables have been generated with the respective methods and included statically in the vignette for illustration purposes.

MSnbase allows easy and flexible access to the data, which allows to visualise data features to assess it’s quality. Some methods are readily available, although many QC approaches will be experiment specific and users are encourage to explore their data.

The plot2d method takes one MSnExp instance as first argument to produce retention time vs. precursor MZ scatter plots. Points represent individual MS2 spectra and can be coloured based on precursor charge (with second argument z="charge"), total ion count (z="ionCount"), number of peaks in the MS2 spectra z="peaks.count") or, when multiple data files were loaded, file z="file"), as illustrated on the next figure. The lower right panel is produced for only a subset of proteins. See the method documentation for more details.

Illustration of the plot2d output.
Illustration of the plot2d output.

The plotDensity method illustrates the distribution of several parameters of interest (see figure below). Similarly to plot2d, the first argument is an MSnExp instance. The second is one of precursor.mz, peaks.count or ionCount, whose density will be plotted. An optional third argument specifies whether the x axes should be logged.

Illustration of the plotDensity output.
Illustration of the plotDensity output.

The plotMzDelta method6 The code to generate the histograms has been contributed by Guangchuang Yu. implements the \(m/z\) delta plot from (Foster et al. 2011) The \(m/z\) delta plot illustrates the suitability of MS2 spectra for identification by plotting the \(m/z\) differences of the most intense peaks. The resulting histogram should optimally shown outstanding bars at amino acid residu masses. More details and parameters are described in the method documentation (?plotMzDelta). The next figure has been generated using the PRIDE experiment 12011, as in (Foster et al. 2011).

Illustration of the plotMzDelta output for the PRIDE experiment 12011, as in figure 4A from (Foster et al. 2011).
Illustration of the plotMzDelta output for the PRIDE experiment 12011, as in figure 4A from (Foster et al. 2011).

In section 12, we illustrate how to assess incomplete reporter ion dissociation.

6 Raw data processing

6.1 Cleaning spectra

There are several methods implemented to perform basic raw data processing and manipulation. Low intensity peaks can be set to 0 with the removePeaks method from spectra or whole experiments. The intensity threshold below which peaks are removed is defined by the t parameter. t can be specified directly as a numeric. The default value is the character "min", that will remove all peaks equal to the lowest non null intensity in any spectrum. We observe the effect of the removePeaks method by comparing total ion count (i.e. the total intensity in a spectrum) with the ionCount method before (object itraqdata) and after (object experiment) for spectrum X55. The respective spectra are shown on figure 8.

experiment <- removePeaks(itraqdata, t = 400, verbose = FALSE)
ionCount(itraqdata[["X55"]])
## [1] 555408.8
ionCount(experiment[["X55"]])
## [1] 499769.6
Same spectrum before (left) and after setting peaks <= 400 to 0.

Figure 8: Same spectrum before (left) and after setting peaks <= 400 to 0

Unlike the name might suggest, the removePeaks method does not actually remove peaks from the spectrum; they are set to 0. This can be checked using the peaksCount method, that returns the number of peaks (including 0 intensity peaks) in a spectrum. To effectively remove 0 intensity peaks from spectra, and reduce the size of the data set, one can use the clean method. The effect of the removePeaks and clean methods are illustrated on figure 9.

peaksCount(itraqdata[["X55"]])
## [1] 1726
peaksCount(experiment[["X55"]])
## [1] 1726
experiment <- clean(experiment, verbose = FALSE)
peaksCount(experiment[["X55"]])
## [1] 440
This figure illustrated the effect or the `removePeaks` and `clean` methods. The left-most spectrum displays two peaks, of max height 3 and 7 respectively. The middle spectrum shows the result of calling `removePeaks` with argument `t=3`, which sets all data points of the first peak, whose maximum height is smaller or equal to `t` to 0. The second peak is unaffected. Calling `clean` after `removePeaks` effectively deletes successive 0 intensities from the spectrum, as shown on the right plot.

Figure 9: This figure illustrated the effect or the removePeaks and clean methods
The left-most spectrum displays two peaks, of max height 3 and 7 respectively. The middle spectrum shows the result of calling removePeaks with argument t=3, which sets all data points of the first peak, whose maximum height is smaller or equal to t to 0. The second peak is unaffected. Calling clean after removePeaks effectively deletes successive 0 intensities from the spectrum, as shown on the right plot.

6.2 Focusing on specific MZ values

Another useful manipulation method is trimMz, that takes as parameters and MSnExp (or a Spectrum) and a numeric mzlim. MZ values smaller then min(mzlim) or greater then max(mzmax) are discarded. This method is particularly useful when one wants to concentrate on a specific MZ range, as for reporter ions quantification, and generally results in substantial reduction of data size. Compare the size of the full trimmed experiment to the original 1.9 Mb.

range(mz(itraqdata[["X55"]]))
## [1] 100.0002 977.6636
experiment <- filterMz(experiment, mzlim = c(112,120))
range(mz(experiment[["X55"]]))
## [1] 102.0612 473.3372
experiment
## MSn experiment data ("MSnExp")
## Object size in memory: 1.18 Mb
## - - - Spectra data - - -
##  MS level(s): 2 
##  Number of spectra: 55 
##  MSn retention times: 19:09 - 50:18 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011 
## Updated from version 0.3.0 to 0.3.1 [Fri Jul  8 20:23:25 2016] 
## Curves <= 400 set to '0': Mon May 18 18:48:19 2026 
## Spectra cleaned: Mon May 18 18:48:19 2026 
##  MSnbase version: 1.1.22 
## - - - Meta data  - - -
## phenoData
##   rowNames: 1
##   varLabels: sampleNames sampleNumbers
##   varMetadata: labelDescription
## Loaded from:
##   dummyiTRAQ.mzXML 
## protocolData: none
## featureData
##   featureNames: X1 X10 ... X9 (55 total)
##   fvarLabels: spectrum ProteinAccession ProteinDescription
##     PeptideSequence
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'

As can be seen above, all processing performed on the experiment is recorded and displayed as integral part of the experiment object.

6.3 Spectrum processing

MSnExp and Spectrum2 instances also support standard MS data processing such as smoothing and peak picking, as described in the smooth and pickPeak manual pages. The methods that either single spectra of experiments, process the spectrum/spectra, and return a updated, processed, object. The implementations originate from the package (Gibb and Strimmer 2012).

7 MS2 isobaric tagging quantitation

7.1 Reporter ions quantitation

Quantitation is performed on fixed peaks in the spectra, that are specified with an ReporterIons object. A specific peak is defined by it’s expected mz value and is searched for within mz \(\pm\) width. If no data is found, NA is returned.

mz(iTRAQ4)
## [1] 114.1112 115.1083 116.1116 117.1150
width(iTRAQ4)
## [1] 0.05

The quantify method takes the following parameters: an MSnExp experiment, a character describing the quantification method, the reporters to be quantified and a strict logical defining whether data points ranging outside of mz \(\pm\) width should be considered for quantitation. Additionally, a progress bar can be displaying when setting the verbose parameter to TRUE. Three quantification methods are implemented, as illustrated on figure 10. Quantitation using sum sums all the data points in the peaks to produce, for this example, 7, whereas method max only uses the peak’s maximum intensity, 3. Trapezoidation calculates the area under the peak taking the full with into account (using strict = FALSE gives 0.375) or only the width as defined by the reporter (using strict = TRUE gives 0.1). See ?quantify for more details.

## Warning in geom_point(aes(x = 114.1, y = 3), alpha = I(1/18), colour = "red", : All aesthetics have length 1, but the data has 7 rows.
## ℹ Please consider using `annotate()` or provide this layer with data containing
##   a single row.
The different quantitation methods. See text for details.

Figure 10: The different quantitation methods
See text for details.

The quantify method returns MSnSet objects, that extend the well-known eSet class defined in the Biobase package. MSnSet instances are very similar to ExpressionSet objects, except for the experiment meta-data that captures MIAPE specific information. The assay data is a matrix of dimensions \(n \times m\), where \(m\) is the number of features/spectra originally in the MSnExp used as parameter in quantify and \(m\) is the number of reporter ions, that can be accessed with the exprs method. The meta data is directly inherited from the MSnExp instance.

qnt <- quantify(experiment,
                method = "trap",
                reporters = iTRAQ4,
                strict = FALSE,
                verbose = FALSE)
qnt
## MSnSet (storageMode: lockedEnvironment)
## assayData: 55 features, 4 samples 
##   element names: exprs 
## protocolData: none
## phenoData
##   sampleNames: iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
##   varLabels: mz reporters
##   varMetadata: labelDescription
## featureData
##   featureNames: X1 X10 ... X9 (55 total)
##   fvarLabels: spectrum ProteinAccession ... collision.energy (15 total)
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation: No annotation 
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011 
## Updated from version 0.3.0 to 0.3.1 [Fri Jul  8 20:23:25 2016] 
## Curves <= 400 set to '0': Mon May 18 18:48:19 2026 
## Spectra cleaned: Mon May 18 18:48:19 2026 
## iTRAQ4 quantification by trapezoidation: Mon May 18 18:48:21 2026 
##  MSnbase version: 1.1.22
head(exprs(qnt))
##     iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1   1347.6158  2247.3097  3927.6931  7661.1463
## X10   739.9861   799.3501   712.5983   940.6793
## X11 27638.3582 33394.0252 32104.2879 26628.7278
## X12 31892.8928 33634.6980 37674.7272 37227.7119
## X13 26143.7542 29677.4781 29089.0593 27902.5608
## X14  6448.0829  6234.1957  6902.8903  6437.2303

The next figure illustrates the quantitation of the TMT 10-plex isobaric tags using the quantify method and the TMT10 reporter instance. The data on the \(x\) axis has been quantified using method = "max" and centroided data (as generated using ProteoWizard’s msconvert with vendor libraries’ peak picking); on the \(y\) axis, the quantitation method was trapezoidation and strict = TRUE (that’s important for TMT 10-plex) and the profile data. We observe a very good correlation.

TMT 10-plex quantitation.
TMT 10-plex quantitation.

If no peak is detected for a reporter ion peak, the respective quantitation value is set to NA. In our case, there is 1 such case in row 41. We will remove the offending line using the filterNA method. The pNA argument defines the percentage of accepted missing values per feature. As we do not expect any missing peaks, we set it to be 0 (which is also the detault value).

table(is.na(qnt))
## 
## FALSE  TRUE 
##   219     1
qnt <- filterNA(qnt, pNA = 0)
sum(is.na(qnt))
## [1] 0

The filtering criteria for filterNA can also be defined as a pattern of columns that can have missing values and columns that must not exhibit any. See ?filterNA for details and examples.

The infrastructure around the MSnSet class allows flexible filtering using the [ sub-setting operator. Below, we mimic the behaviour of filterNA(, pNA = 0) by calculating the row indices that should be removed, i.e. those that have at least one NA value and explicitly remove these rows. This method allows one to devise and easily apply any filtering strategy.

whichRow <- which(is.na((qnt))) %% nrow(qnt)
qnt <- qnt[-whichRow, ]

See also the plotNA method to obtain a graphical overview of the completeness of a data set.

7.2 Importing quantitation data

If quantitation data is already available as a spreadsheet, it can be imported, along with additional optional feature and sample (pheno) meta data, with the readMSnSet function. This function takes the respective text-based spreadsheet (comma- or tab-separated) file names as argument to create a valid MSnSet instance.

Note that the quantitation data of MSnSet objects can also be exported to a text-based spreadsheet file using the write.exps method.

MSnbase also supports the mzTab format, a light-weight, tab-delimited file format for proteomics data. mzTab files can be read into R with readMzTabData to create and MSnSet instance.

See the MSnbase-io vignette for a general overview of MSnbase’s input/ouput capabilites.

7.3 Importing chromatographic data from SRM/MRM experiments

Data from SRM/MRM experiments can be imported from mzML files using the readSRMData function. The mzML files are expected to contain chromatographic data for the same precursor and product m/z values. The function returns a MChromatograms object that arranges the data in a two-dimensional array, each column representing the data of one file (sample) and each row the chromatographic data for the same polarity, precursor and product m/z. In the example code below we load a single SRM file using readSRMData.

fl <- proteomics(full.names = TRUE, pattern = "MRM")
srm <- readSRMData(fl)

srm
## MChromatograms with 137 rows and 1 column
##                     1
##        <Chromatogram>
## [1,]      length: 523
## [2,]      length: 523
## ...              ... 
## [136,]    length: 962
## [137,]    length: 962
## phenoData with 1 variables
## featureData with 10 variables

The precursor and product m/z values can be extracted with the precursorMz and productMz functions. These functions always return a matrix, each row providing the lower and upper m/z value of the isolation window (in most cases minimal and maximal m/z will be identical).

head(precursorMz(srm))
##      mzmin mzmax
## [1,]   115   115
## [2,]   115   115
## [3,]   117   117
## [4,]   117   117
## [5,]   133   133
## [6,]   133   133
head(productMz(srm))
##        mzmin   mzmax
## [1,]  26.996  26.996
## [2,]  70.996  70.996
## [3,]  72.996  72.996
## [4,]  98.996  98.996
## [5,] 114.996 114.996
## [6,]  70.996  70.996

7.4 Peak adjustments

Single peak adjustment In certain cases, peak intensities need to be adjusted as a result of peak interferance. For example, the \(+1\) peak of the phenylalanine (F, Phe) immonium ion (with \(m/z\) 120.03) inteferes with the 121.1 TMT reporter ion. Below, we calculate the relative intensity of the +1 peaks compared to the main peak using the Rdisop package.

library(Rdisop)
## Phenylalanine immonium ion
Fim <- getMolecule("C8H10N")
getMass(Fim)
## [1] 120.0813
isotopes <- getIsotope(Fim)
F1 <- isotopes[[1]][2, 2]
F1
## [1] 0.08339707

If desired, one can thus specifically quantify the F immonium ion in the MS2 spectrum, estimate the intensity of the +1 ion (0.0834% of the F peak) and substract this calculated value from the 121.1 TMT reporter intensity.

The above principle can also be generalised for a set of overlapping peaks, as described below.

Reporter ions purity correction Impurities in the reporter reagents can also bias the results and can be corrected when manufacturers provide correction coefficients. These generally come as percentages of each reporter ion that have masses differing by -2, -1, +1 and +2 Da from the nominal reporter ion mass due to isotopic variants. The purityCorrect method applies such correction to MSnSet instances. It also requires a square matrix as second argument, impurities, that defines the relative percentage of reporter in the quantified each peak. See ?purityCorrect for more details.

impurities <- matrix(c(0.929, 0.059, 0.002, 0.000,
                       0.020, 0.923, 0.056, 0.001,
                       0.000, 0.030, 0.924, 0.045,
                       0.000, 0.001, 0.040, 0.923),
                     nrow = 4)
qnt.crct <- purityCorrect(qnt, impurities)
head(exprs(qnt))
##     iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1   1347.6158  2247.3097  3927.6931  7661.1463
## X10   739.9861   799.3501   712.5983   940.6793
## X11 27638.3582 33394.0252 32104.2879 26628.7278
## X12 31892.8928 33634.6980 37674.7272 37227.7119
## X13 26143.7542 29677.4781 29089.0593 27902.5608
## X14  6448.0829  6234.1957  6902.8903  6437.2303
head(exprs(qnt.crct))
##     iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1   1304.7675  2168.1082  3784.2244  8133.9211
## X10   743.8159   806.5647   696.9024   988.0787
## X11 27547.6515 33592.3997 32319.1803 27413.1833
## X12 32127.1898 33408.8353 37806.0787 38658.7865
## X13 26187.3141 29788.6254 29105.2485 28936.6871
## X14  6533.1862  6184.1103  6945.2074  6666.5633

The makeImpuritiesMatrix can be used to create impurity matrices. It opens a rudimentary spreadsheet that can be directly edited.

8 Processing quantitative data

8.1 Data imputation

A set of imputation methods are available in the impute method: it takes an MSnSet instance as input, the name of the imputation method to be applied (one of bpca, knn, QRILC, MLE, MLE2, MinDet, MinProb, min, zero, mixed, nbavg, with, RF, none), possible additional parameters and returns an updated for MSnSet without any missing values. Below, we apply a deterministic minimum value imputation on the naset example data:

## an example MSnSet containing missing values
data(naset)
table(is.na(naset))
## 
## FALSE  TRUE 
## 10254   770
## number of NAs per protein
table(fData(naset)$nNA)
## 
##   0   1   2   3   4   8   9  10 
## 301 247  91  13   2  23  10   2
x <- impute(naset, "min")
processingData(x)
## - - - Processing information - - -
## Data imputation using min Mon May 18 18:48:22 2026 
##  MSnbase version: 1.15.6
table(is.na(x))
## 
## FALSE 
## 11024

As described in more details in (Lazar et al. 2016), there are two types of mechanisms resulting in missing values in LC/MSMS experiments.

  • Missing values resulting from absence of detection of a feature, despite ions being present at detectable concentrations. For example in the case of ion suppression or as a result from the stochastic, data-dependent nature of the MS acquisition method. These missing value are expected to be randomly distributed in the data and are defined as missing at random (MAR) or missing completely at random (MCAR).

  • Biologically relevant missing values, resulting from the absence of the low abundance of ions (below the limit of detection of the instrument). These missing values are not expected to be randomly distributed in the data and are defined as missing not at random (MNAR).

MAR and MCAR values can be reasonably well tackled by many imputation methods. MNAR data, however, requires some knowledge about the underlying mechanism that generates the missing data, to be able to attempt data imputation. MNAR features should ideally be imputed with a left-censor (for example using a deterministic or probabilistic minimum value) method. Conversely, it is recommended to use hot deck methods (for example nearest neighbour, maximum likelihood, etc) when data are missing at random.

Mixed imputation method. Black cells represent presence of quantitation values and light grey corresponds to missing data. The two groups of interest are depicted in green and blue along the heatmap columns. Two classes of proteins are annotated on the left: yellow are proteins with randomly occurring missing values (if any) while proteins in brown are candidates for non-random missing value imputation.

Figure 11: Mixed imputation method
Black cells represent presence of quantitation values and light grey corresponds to missing data. The two groups of interest are depicted in green and blue along the heatmap columns. Two classes of proteins are annotated on the left: yellow are proteins with randomly occurring missing values (if any) while proteins in brown are candidates for non-random missing value imputation.

It is anticipated that the identification of both classes of missing values will depend on various factors, such as feature intensities and experimental design. Below, we use perform mixed imputation, applying nearest neighbour imputation on the 654 features that are assumed to contain randomly distributed missing values (if any) (yellow on figure 11) and a deterministic minimum value imputation on the 35 proteins that display a non-random pattern of missing values (brown on figure 11).

x <- impute(naset, method = "mixed",
            randna = fData(naset)$randna,
            mar = "knn", mnar = "min")
## Imputing along margin 1 (features/rows).
x
## MSnSet (storageMode: lockedEnvironment)
## assayData: 689 features, 16 samples 
##   element names: exprs 
## protocolData: none
## phenoData
##   sampleNames: M1F1A M1F4A ... M2F11B (16 total)
##   varLabels: nNA
##   varMetadata: labelDescription
## featureData
##   featureNames: AT1G09210 AT1G21750 ... AT4G39080 (689 total)
##   fvarLabels: nNA randna
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:  
## - - - Processing information - - -
## Data imputation using mixed Mon May 18 18:48:22 2026 
##  MSnbase version: 1.15.6

Please read ?MsCoreUtils::impute_matix() for a description of the different methods.

8.2 Normalisation

A MSnSet object is meant to be compatible with further downstream packages for data normalisation and statistical analysis. There is also a normalise (also available as normalize) method for expression sets. The method takes and instance of class MSnSet as first argument, and a character to describe the method to be used:

  • quantiles: Applies quantile normalisation (Bolstad et al. 2003) as implemented in the normalize.quantiles function of the preprocessCore package.

  • quantiles.robust: Applies robust quantile normalisation (Bolstad et al. 2003) as implemented in the normalize.quantiles.robust function of the preprocessCore package.

  • vsn: Applies variance stabilisation normalization (Huber et al. 2002) as implemented in the vsn2 function of the vsn package.

  • max: Each feature’s reporter intensity is divided by the maximum of the reporter ions intensities.

  • sum: Each feature’s reporter intensity is divided by the sum of the reporter ions intensities.

See ?normalise for more methods. A scale method for MSnSet instances, that relies on the base::scale function.

qnt.max <- normalise(qnt, "max")
qnt.sum <- normalise(qnt, "sum")
qnt.quant <- normalise(qnt, "quantiles")
qnt.qrob <- normalise(qnt, "quantiles.robust")
qnt.vsn <- normalise(qnt, "vsn")

The effect of these are illustrated on figure 12 and figure 13 reproduces figure 3 of (Karp et al. 2010) that described the application of vsn on iTRAQ reporter data.

Comparison of the normalisation *MSnSet* methods. Note that vsn also glog-transforms the intensities.

Figure 12: Comparison of the normalisation MSnSet methods
Note that vsn also glog-transforms the intensities.

## Warning: `qplot()` was deprecated in ggplot2 3.4.0.
## This warning is displayed once per session.
## Call `lifecycle::last_lifecycle_warnings()` to see where this warning was
## generated.
CV versus signal intensity comparison for log2 and vsn transformed data. Lines indicate running CV medians.

Figure 13: CV versus signal intensity comparison for log2 and vsn transformed data
Lines indicate running CV medians.

Note that it is also possible to normalise individual spectra or whole MSnExp experiments with the normalise method using the max method. This will rescale all peaks between 0 and 1. To visualise the relative reporter peaks, one should this first trim the spectra using method trimMz as illustrated in section 6, then normalise the MSnExp with normalise using method="max" as illustrated above and plot the data using plot (figure 14).

Experiment-wide normalised MS2 spectra. The y-axes of the individual spectra is now rescaled between 0 and 1 (highest peak), as opposed to figure \@ref(fig:msnexpPlot).

Figure 14: Experiment-wide normalised MS2 spectra
The y-axes of the individual spectra is now rescaled between 0 and 1 (highest peak), as opposed to figure 5.

Additional dedicated normalisation method are available for MS2 label-free quantitation, as described in section 10 and in the quantify documentation.

9 Feature aggregation

The above quantitation and normalisation has been performed on quantitative data obtained from individual spectra. However, the biological unit of interest is not the spectrum but the peptide or the protein. As such, it is important to be able to summarise features that belong to a same group, i.e. spectra from one peptide, peptides that originate from one protein, or directly combine all spectra that have been uniquely associated to one protein.

MSnbase provides one function, combineFeatures, that allows to aggregate features stored in an MSnSet using build-in or user defined summary function and return a new MSnSet instance. The three main arguments are described below. Additional details can be found in the method documentation.

combineFeatures’s first argument, object, is an instance of class MSnSet, as has been created in the section 7.1 for instance. The second argument, groupBy, is a factor than has as many elements as there are features in the MSnSet object argument. The features corresponding to the groupBy levels will be aggregated so that the resulting MSnSet output will have length(levels(groupBy)) features. Here, we will combine individual MS2 spectra based on the protein they originate from. As shown below, this will result in 40 new aggregated features.

gb <- fData(qnt)$ProteinAccession
table(gb)
## gb
##     BSA ECA0172 ECA0435 ECA0452 ECA0469 ECA0621 ECA0631 ECA0691 ECA0871 ECA0978 
##       3       1       2       1       2       1       1       1       1       1 
## ECA1032 ECA1093 ECA1104 ECA1294 ECA1362 ECA1363 ECA1364 ECA1422 ECA1443 ECA2186 
##       1       1       1       1       1       1       1       1       1       1 
## ECA2391 ECA2421 ECA2831 ECA3082 ECA3175 ECA3349 ECA3356 ECA3377 ECA3566 ECA3882 
##       1       1       1       1       1       2       1       1       2       1 
## ECA3929 ECA3969 ECA4013 ECA4026 ECA4030 ECA4037 ECA4512 ECA4513 ECA4514     ENO 
##       1       1       1       2       1       1       1       1       6       3
length(unique(gb))
## [1] 40

The third argument, method, defined how to combine the features. Predefined functions are readily available and can be specified as strings (method="mean", method="median", method="sum", method="weighted.mean" or method="medianpolish" to compute respectively the mean, media, sum, weighted mean or median polish of the features to be aggregated). Alternatively, is is possible to supply user defined functions with method=function(x) { ... }. We will use the median here.

qnt2 <- combineFeatures(qnt, groupBy = gb, method = "median")
qnt2
## MSnSet (storageMode: lockedEnvironment)
## assayData: 40 features, 4 samples 
##   element names: exprs 
## protocolData: none
## phenoData
##   sampleNames: iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
##   varLabels: mz reporters
##   varMetadata: labelDescription
## featureData
##   featureNames: BSA ECA0172 ... ENO (40 total)
##   fvarLabels: spectrum ProteinAccession ... CV.iTRAQ4.117 (19 total)
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:  
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011 
## Updated from version 0.3.0 to 0.3.1 [Fri Jul  8 20:23:25 2016] 
## Curves <= 400 set to '0': Mon May 18 18:48:19 2026 
## Spectra cleaned: Mon May 18 18:48:19 2026 
## iTRAQ4 quantification by trapezoidation: Mon May 18 18:48:21 2026 
## Subset [55,4][54,4] Mon May 18 18:48:21 2026 
## Removed features with more than 0 NAs: Mon May 18 18:48:21 2026 
## Dropped featureData's levels Mon May 18 18:48:21 2026 
## Combined 54 features into 40 using median: Mon May 18 18:48:23 2026 
##  MSnbase version: 2.39.1

Of interest is also the iPQF spectra-to-protein summarisation method, which integrates peptide spectra characteristics and quantitative values for protein quantitation estimation. See ?iPQF and references therein for details.

10 Label-free MS2 quantitation

10.1 Peptide counting

Note that if samples are not multiplexed, label-free MS2 quantitation by spectral counting is possible using MSnbase. Once individual spectra have been assigned to peptides and proteins (see section 4), it becomes straightforward to estimate protein quantities using the simple peptide counting method, as illustrated in section 9.

sc <- quantify(msexp, method = "count")
## lets modify out data for demonstration purposes
fData(sc)$DatabaseAccess[1] <- fData(sc)$DatabaseAccess[2]
fData(sc)$DatabaseAccess
## [1] "ECA1028" "ECA1028" "ECA0510"
sc <- combineFeatures(sc, groupBy = fData(sc)$DatabaseAccess,
                      method = "sum")
exprs(sc)
##         dummyiTRAQ.mzXML
## ECA0510                1
## ECA1028                2

Such count data could then be further analyses using dedicated count methods (originally developed for high-throughput sequencing) and directly available for MSnSet instances in the msmsTests Bioconductor package.

10.2 Spectral counting and intensity methods

The spectral abundance factor (SAF) and the normalised form (NSAF) (Paoletti et al. 2006) as well as the spectral index (SI) and other normalised variations (SI\(_{GI}\) and SI\(_N\)) (Griffin et al. 2010) are also available. Below, we illustrate how to apply the normalised SI\(_N\) to the experiment containing identification data produced in section 4.

The spectra that did not match any peptide have already been remove with the removeNoId method. As can be seen in the following code chunk, the first spectrum could not be matched to any single protein. Non-identified spectra and those matching multiple proteins are removed automatically prior to any label-free quantitation. Once can also remove peptide that do not match uniquely to proteins (as defined by the nprot feature variable column) with the removeMultipleAssignment method.

fData(msexp)[, c("DatabaseAccess", "nprot")]
##       DatabaseAccess nprot
## F1.S1        ECA0984     1
## F1.S2        ECA1028     1
## F1.S5        ECA0510     1

Note that the label-free methods implicitely apply feature aggregation (section 9) and normalise (section 8.2) the quantitation values based on the total sample intensity and or the protein lengths (see (Paoletti et al. 2006) and (Griffin et al. 2010) for details).

Let’s now proceed with the quantitation using the quantify, as in section 7.1, this time however specifying the method of interest, SIn (the reporters argument can of course be ignored here). The required peptide-protein mapping and protein lengths are extracted automatically from the feature meta-data using the default accession and length feature variables.

siquant <- quantify(msexp, method = "SIn")
processingData(siquant)
## - - - Processing information - - -
## Data loaded: Mon May 18 18:48:18 2026 
## Filtered 2 unidentified peptides out [Mon May 18 18:48:19 2026] 
## Quantitation by total ion current [Mon May 18 18:48:23 2026] 
## Combined 3 features into 3 using sum: Mon May 18 18:48:23 2026 
## Quantification by SIn [Mon May 18 18:48:23 2026] 
##  MSnbase version: 2.39.1
exprs(siquant)
##         dummyiTRAQ.mzXML
## ECA0510     0.0006553518
## ECA0984     0.0035384487
## ECA1028     0.0002684726

Other label-free methods can be applied by specifiying the appropriate method argument. See ?quantify for more details.

11 Spectra comparison

11.1 Plotting two spectra

MSnbase provides functionality to compare spectra against each other. The first notable function is plot. If two Spectrum2 objects are provided plot will draw two plots: the upper and lower panel contain respectively the first and second spectrum. Common peaks are drawn in a slightly darker colour.

centroided <- pickPeaks(itraqdata, verbose = FALSE)
(k <- which(fData(centroided)[, "PeptideSequence"] == "TAGIQIVADDLTVTNPK"))
## [1] 41 42
mzk <- precursorMz(centroided)[k]
zk <- precursorCharge(centroided)[k]
mzk * zk
##      X46      X47 
## 2046.175 2045.169
plot(centroided[[k[1]]], centroided[[k[2]]])
Comparing two MS2 spectra.

Figure 15: Comparing two MS2 spectra

11.2 Comparison metrics

Currently MSnbase supports three different metrics to compare spectra against each other: common to calculate the number of common peaks, cor to calculate the Pearson correlation and dotproduct to calculate the dot product. See ?compareSpectra to apply other arbitrary metrics.

compareSpectra(centroided[[2]], centroided[[3]],
               fun = "common")
## [1] 8
compareSpectra(centroided[[2]], centroided[[3]],
               fun = "cor")
## [1] 0.1105021
compareSpectra(centroided[[2]], centroided[[3]],
               fun = "dotproduct")
## [1] 0.1185025

compareSpectra supports MSnExp objects as well.

compmat <- compareSpectra(centroided, fun="cor")
compmat[1:10, 1:5]
##             X1        X10        X11        X12        X13
## X1          NA 0.07672973 0.38024702 0.51579989 0.46647324
## X10 0.07672973         NA 0.11050214 0.11162512 0.08611906
## X11 0.38024702 0.11050214         NA 0.47184437 0.47905818
## X12 0.51579989 0.11162512 0.47184437         NA 0.57909089
## X13 0.46647324 0.08611906 0.47905818 0.57909089         NA
## X14 0.09999703 0.01558385 0.12165400 0.12057251 0.11853321
## X15 0.03314059 0.00416184 0.01733228 0.04796236 0.03196115
## X16 0.39140514 0.06634870 0.42259036 0.45624614 0.45469020
## X17 0.37945538 0.07188420 0.52292845 0.44791250 0.43679447
## X18 0.55367861 0.10286983 0.56621755 0.66884285 0.64262061

Below, we illustrate how to compare a set of spectra using a hierarchical clustering.

plot(hclust(as.dist(compmat)))

12 Quantitative assessment of incomplete dissociation

Quantitation using isobaric reporter tags assumes complete dissociation between the reporter group (red on the figure below), balance group (blue) and peptide (the peptide reactive group is drawn in green). However, incomplete dissociation does occur and results in an isobaric tag (i.e reporter and balance groups) specific peaks.

iTRAQ 4-plex isobaric tags reagent consist of three parts: (1) a charged reporter group (MZ of 114, 115, 116 and 117) that is unique to each of the four reagents (red), (2) an uncharged mass balance group (28-31 Da) (blue)and (3) a peptide reactive group (NHS ester) that binds to the peptide. In case of incomplete dissociation, the reporter and balance groups produce a specific peaks at MZ 145.
iTRAQ 4-plex isobaric tags reagent consist of three parts: (1) a charged reporter group (MZ of 114, 115, 116 and 117) that is unique to each of the four reagents (red), (2) an uncharged mass balance group (28-31 Da) (blue)and (3) a peptide reactive group (NHS ester) that binds to the peptide. In case of incomplete dissociation, the reporter and balance groups produce a specific peaks at MZ 145.

MSnbase provides, among others, a ReporterIons object for iTRAQ 4-plex that includes the 145 peaks, called iTRAQ5. This can then be used to quantify the experiment as show in section 7.1 to estimate incomplete dissociation for each spectrum.

iTRAQ5
## Object of class "ReporterIons"
## iTRAQ5: '4-plex iTRAQ and reporter + balance group' with 5 reporter ions
##  - [iTRAQ5.114] 114.1112 +/- 0.05 (red)
##  - [iTRAQ5.115] 115.1083 +/- 0.05 (green)
##  - [iTRAQ5.116] 116.1116 +/- 0.05 (blue)
##  - [iTRAQ5.117] 117.115 +/- 0.05 (yellow)
##  - [iTRAQ5.145] 145.1 +/- 0.05 (grey)
incompdiss <- quantify(itraqdata,
                       method = "trap",
                       reporters = iTRAQ5,
                       strict = FALSE,
                       verbose = FALSE)
head(exprs(incompdiss))
##     iTRAQ5.114 iTRAQ5.115 iTRAQ5.116 iTRAQ5.117 iTRAQ5.145
## X1   1347.6158  2247.3097  3927.6931  7661.1463  2063.8947
## X10   739.9861   799.3501   712.5983   940.6793   467.3615
## X11 27638.3582 33394.0252 32104.2879 26628.7278 13543.4565
## X12 31892.8928 33634.6980 37674.7272 37227.7119 11839.2558
## X13 26143.7542 29677.4781 29089.0593 27902.5608 12206.5508
## X14  6448.0829  6234.1957  6902.8903  6437.2303   427.6654

Figure 16 compares these intensities for the whole experiment.

## `geom_smooth()` using formula = 'y ~ x'
Boxplot and scatterplot comparing intensities of the 4 reporter ions (or their sum, on the right) and the incomplete dissociation specific peak.

Figure 16: Boxplot and scatterplot comparing intensities of the 4 reporter ions (or their sum, on the right) and the incomplete dissociation specific peak

13 Combining MSnSet instances

Combining mass spectrometry runs can be done in two different ways depending on the nature of these runs. If the runs represent repeated measures of identical samples, for instance multiple fractions, the data has to be combine along the row of the quantitation matrix: all the features (along the rows) represent measurements of the same set of samples (along the columns). In this situation, described in section 13.1, two experiments of dimensions \(n_1\) (rows) by \(m\) (columns and \(n_2\) by \(m\) will produce a new experiment of dimensions \(n_1 + n_2\) by \(m\).

When however, different sets of samples have been analysed in different mass spectrometry runs, the data has to be combined along the columns of the quantitation matrix: some features will be shared across experiments and should thus be aligned on a same row in the new data set, whereas unique features to one experiment should be set as missing in the other one. In this situation, described in section 13.2, two experiments of dimensions \(n_1\) by \(m_1\) and \(n_2\) by \(m_2\) will produce a new experiment of dimensions \(unique_{n_1} + unique_{n_2} + shared_{n_1, n_2}\) by \(m_1 + m_2\). The two first terms of the first dimension will be complemented by NA values.

Default MSnSet feature names (X1, X2, …) and sample names (iTRAQ4.114, iTRAQ4.115, iTRAQ4.116, …) are not informative. The features and samples of these anonymous quantitative data-sets should be updated before being combined, to guide how to meaningfully merge them.

13.1 Combining identical samples

To simulate this situation, let us use quantiation data from the itraqdata object that is provided with the package as experiment 1 and the data from the rawdata MSnExp instance created at the very beginning of this document. Both experiments share the same default iTRAQ 4-plex reporter names as default sample names, and will thus automatically be combined along rows.

exp1 <- quantify(itraqdata, reporters = iTRAQ4,
                 verbose = FALSE)
sampleNames(exp1)
## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"
centroided(rawdata) <- FALSE
exp2 <- quantify(rawdata, reporters = iTRAQ4,
                 verbose = FALSE)
sampleNames(exp2)
## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"

It important to note that the features of these independent experiments share the same default anonymous names: X1, X2, X3, …, that however represent quantitation of distinct physical analytes. If the experiments were to be combined as is, it would result in an error because data points for the same feature name (say X1) and the same sample name (say iTRAQ4.114) have different values. We thus first update the feature names to explicitate that they originate from different experiment and represent quantitation from different spectra using the convenience function updateFeatureNames. Note that updating the names of one experiment would suffice here.

head(featureNames(exp1))
## [1] "X1"  "X10" "X11" "X12" "X13" "X14"
exp1 <- updateFeatureNames(exp1)
head(featureNames(exp1))
## [1] "X1.exp1"  "X10.exp1" "X11.exp1" "X12.exp1" "X13.exp1" "X14.exp1"
head(featureNames(exp2))
## [1] "F1.S1" "F1.S2" "F1.S3" "F1.S4" "F1.S5"
exp2 <- updateFeatureNames(exp2)
head(featureNames(exp2))
## [1] "F1.S1.exp2" "F1.S2.exp2" "F1.S3.exp2" "F1.S4.exp2" "F1.S5.exp2"

The two experiments now share the same sample names and have different feature names and will be combined along the row. Note that all meta-data is correctly combined along the quantitation values.

exp12 <- combine(exp1, exp2)
## Warning in combine(experimentData(x), experimentData(y)): 
##   unknown or conflicting information in MIAPE field 'email'; using information from first object 'x'
dim(exp1)
## [1] 55  4
dim(exp2)
## [1] 5 4
dim(exp12)
## [1] 60  4

13.2 Combine different samples

Lets now create two MSnSets from the same raw data to simulate two different independent experiments that share some features. As done previously (see section 9), we combine the spectra based on the proteins they have been identified to belong to. Features can thus naturally be named using protein accession numbers. Alternatively, if peptide sequences would have been used as grouping factor in combineFeatures, then these would be good feature name candidates.

set.seed(1)
i <- sample(length(itraqdata), 35)
j <- sample(length(itraqdata), 35)
exp1 <- quantify(itraqdata[i], reporters = iTRAQ4,
                 verbose = FALSE)
exp2 <- quantify(itraqdata[j], reporters = iTRAQ4,
                 verbose = FALSE)
exp1 <- droplevels(exp1)
exp2 <- droplevels(exp2)
table(featureNames(exp1) %in% featureNames(exp2))
## 
## FALSE  TRUE 
##    14    21
exp1 <- combineFeatures(exp1,
                        groupBy = fData(exp1)$ProteinAccession)
exp2 <- combineFeatures(exp2,
                        groupBy = fData(exp2)$ProteinAccession)
## Your data contains missing values. Please read the relevant section in
## the combineFeatures manual page for details on the effects of missing
## values on data aggregation.
head(featureNames(exp1))
## [1] "BSA"     "ECA0172" "ECA0469" "ECA0631" "ECA0691" "ECA0871"
head(featureNames(exp2))
## [1] "BSA"     "ECA0435" "ECA0469" "ECA0621" "ECA0871" "ECA1032"

The droplevels drops the unused featureData levels. This is required to avoid passing absent levels as groupBy in combineFeatures. Alternatively, one could also use factor(fData(exp1)\$ProteinAccession) as groupBy argument.

The feature names are updated automatically by combineFeatures, using the groupBy argument. Proper feature names, reflecting the nature of the features (spectra, peptides or proteins) is critical when multiple experiments are to be combined, as this is done using common features as defined by their names (see below).

Sample names should also be updated to replace anonymous reporter names with relevant identifiers; the individual reporter data is stored in the phenoData and is not lost. A convenience function updateSampleNames is provided to append the MSnSet’s variable name to the already defined names, although in general, biologically relevant identifiers are preferred.

sampleNames(exp1)
## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"
exp1 <- updateSampleNames(exp1)
sampleNames(exp1)
## [1] "iTRAQ4.114.exp1" "iTRAQ4.115.exp1" "iTRAQ4.116.exp1" "iTRAQ4.117.exp1"
sampleNames(exp1) <- c("Ctrl1", "Cond1", "Ctrl2", "Cond2")
sampleNames(exp2) <- c("Ctrl3", "Cond3", "Ctrl4", "Cond4")

At this stage, it is not yet possible to combine the two experiments, because their feature data is not compatible yet; they share the same feature variable labels, i.e. the feature data column names (spectrum, ProteinAccession, ProteinDescription, …), but the part of the content is different because the original data was (in particular all the spectrum centric data: identical peptides in different runs will have different retention times, precursor intensities, …). Feature data with identical labels (columns in the data frame) and names (row in the data frame) are expected to have the same data and produce an error if not conform.

stopifnot(all(fvarLabels(exp1) == fvarLabels(exp2)))
fData(exp1)["BSA", 1:4]
##     spectrum ProteinAccession   ProteinDescription PeptideSequence
## BSA        1              BSA bovine serum albumin          NYQEAK
fData(exp2)["BSA", 1:4]
##     spectrum ProteinAccession   ProteinDescription PeptideSequence
## BSA        1              BSA bovine serum albumin          NYQEAK

Instead of removing these identical feature data columns, one can use a second convenience function, updateFvarLabels, to update feature labels based on the experiements variable name and maintain all the metadata.

exp1 <- updateFvarLabels(exp1)
exp2 <- updateFvarLabels(exp2)
head(fvarLabels(exp1))
## [1] "spectrum.exp1"           "ProteinAccession.exp1"  
## [3] "ProteinDescription.exp1" "PeptideSequence.exp1"   
## [5] "fileIdx.exp1"            "retention.time.exp1"
head(fvarLabels(exp2))
## [1] "spectrum.exp2"           "ProteinAccession.exp2"  
## [3] "ProteinDescription.exp2" "PeptideSequence.exp2"   
## [5] "fileIdx.exp2"            "retention.time.exp2"

It is now possible to combine exp1 and exp2, including all the meta-data, with the combine method. The new experiment will contain the union of the feature names of the individual experiments with missing values inserted appropriately.

exp12 <- combine(exp1, exp2)
dim(exp12)
## [1] 36  8
pData(exp12)
##             mz reporters
## Ctrl1 114.1112    iTRAQ4
## Cond1 115.1083    iTRAQ4
## Ctrl2 116.1116    iTRAQ4
## Cond2 117.1150    iTRAQ4
## Ctrl3 114.1112    iTRAQ4
## Cond3 115.1083    iTRAQ4
## Ctrl4 116.1116    iTRAQ4
## Cond4 117.1150    iTRAQ4
exprs(exp12)[25:28, ]
##             Ctrl1     Cond1     Ctrl2     Cond2     Ctrl3     Cond3     Ctrl4
## ECA4513 10154.953 10486.943 11018.191 11289.552        NA        NA        NA
## ECA4514  6516.397  6746.337  6658.973  6838.491 12457.173 12695.491 14423.640
## ENO     77239.040 49352.793 22493.050 11187.588 39965.733 24967.397        NA
## ECA0435        NA        NA        NA        NA  4923.628  5557.818  5775.203
##             Cond4
## ECA4513        NA
## ECA4514 14556.855
## ENO      5925.663
## ECA0435  5079.295
exp12
## MSnSet (storageMode: lockedEnvironment)
## assayData: 36 features, 8 samples 
##   element names: exprs 
## protocolData: none
## phenoData
##   sampleNames: Ctrl1 Cond1 ... Cond4 (8 total)
##   varLabels: mz reporters
##   varMetadata: labelDescription
## featureData
##   featureNames: BSA ECA0172 ... ECA4037 (36 total)
##   fvarLabels: spectrum.exp1 ProteinAccession.exp1 ...
##     CV.iTRAQ4.117.exp2 (38 total)
##   fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:  
## - - - Processing information - - -
## Combined [27,4] and [24,4] MSnSets Mon May 18 18:48:27 2026 
##  MSnbase version: 2.39.1

In summary, when experiments with different samples need to be combined (along the columns), one needs to (1) clarify the sample names using updateSampleNames or better manually, for biological relevance and (2) update the feature data variable labels with updateFvarLabels. The individual experiments (there can be more than 2) can then easily be combined with the combine method while retaining the meta-data.

If runs for the same sample (different fractions for example) need to be combines, one needs to (1) differentiate the feature provenance with updateFeatureNames prior to use combine.

13.3 Splitting and unsplitting MSnSet instances

A single MSnSet can also be split along the features/rows or samples/columns using the split method and a factor defining the splitting groups, resulting in an instance of class MSnSetList:

data(dunkley2006)
head(pData(dunkley2006))
##        membrane.prep fraction replicate
## M1F1A              1        1         A
## M1F4A              1        4         A
## M1F7A              1        7         A
## M1F11A             1       11         A
## M1F2B              1        2         B
## M1F5B              1        5         B
split(dunkley2006, dunkley2006$replicate)
## Instance of class 'MSnSetList' containig 2 objects.
## or, defining the appropriate annotation variable name
dun <- split(dunkley2006, "replicate")

Above, we split along the columns/samples, but the function would equally work with a factor of length equal to the number of rows of the MSnSet (or a feature variable name) to split along the rows/features.

Finally, the effect of split can be reverted by unsplit.

dun2 <- unsplit(dun, pData(dunkley2006)$replicate)
compareMSnSets(dunkley2006, dun2)
## [1] TRUE

See ?MSnSetList for more details about the class, split and unsplit and comments about storing multiple assays pertaining the same experiment.

13.4 Averaging MSnSet instances

It is sometimes useful to average a set of replicated experiments to facilitate their visualisation. This can be easily achieved with the averageMSnSet function, which takes a list of valid MSnSet instances as input and creates a new object whose expression values are an average of the original values. A value of dispersion (disp) and a count of missing values (nNA) is recorded in the feature metadata slot. The average and dispersion are computed by default as the median and (non-parametric) coefficient of variation (see ?npcv for details), although this can easily be parametrised, as described in ?averageMSnSet.

The next code chunk illustrates the averaging function using three replicated experiments from (Tan et al. 2009) available in the pRolocdata package.

library("pRolocdata")
data(tan2009r1)
data(tan2009r2)
data(tan2009r3)
msnl <- MSnSetList(list(tan2009r1, tan2009r2, tan2009r3))
avgtan <- averageMSnSet(msnl)
head(exprs(avgtan))
##             X114      X115      X116      X117
## P20353 0.3605000 0.3035000 0.2095000 0.1265000
## P53501 0.4299090 0.1779700 0.2068280 0.1852625
## Q7KU78 0.1704443 0.1234443 0.1772223 0.5290000
## P04412 0.2567500 0.2210000 0.3015000 0.2205000
## Q7KJ73 0.2160000 0.1830000 0.3420000 0.2590000
## Q7JZN0 0.0965000 0.2509443 0.4771667 0.1750557
head(fData(avgtan)$disp)
##               X114      X115        X116       X117
## P20353 0.076083495 0.1099127 0.109691169 0.14650198
## P53501 0.034172542 0.2640556 0.005139653 0.17104568
## Q7KU78 0.023198743 0.4483795 0.027883087 0.04764499
## P04412 0.053414021 0.2146751 0.090972139 0.27903810
## Q7KJ73 0.000000000 0.0000000 0.000000000 0.00000000
## Q7JZN0 0.007681865 0.1959534 0.097873350 0.06210542
head(fData(avgtan)$nNA)
##        X114 X115 X116 X117
## P20353    1    1    1    1
## P53501    1    1    1    1
## Q7KU78    0    0    0    0
## P04412    1    1    1    1
## Q7KJ73    2    2    2    2
## Q7JZN0    0    0    0    0

We are going to visualise the average data on a principle component (PCA) plot using the plot2D function from the pRoloc package (Gatto et al. 2014). In addition, we are going to use the measure of dispersion to highlight averages with high variability by taking, for each protein, the maximum observed dispersion in the 4 samples. Note that in the default implementation, dispersions estimated from a single measurement (i.e. that had 2 missing values in our example) are set to 0; we will set these to the overal maximum observed dispersion.

disp <- rowMax(fData(avgtan)$disp)
disp[disp == 0] <- max(disp)
range(disp)
## [1] 0.01152877 1.20888923
library("pRoloc")
plot2D(avgtan, cex = 3 * disp)
PCA plot of the averaged *MSnSet*. The point sizes are proportional to the dispersion of the protein quantitation across the averaged data.

Figure 17: PCA plot of the averaged MSnSet
The point sizes are proportional to the dispersion of the protein quantitation across the averaged data.

14 MSE data processing

MSnbase can also be used for MSE data independent acquisition from Waters instrument. The MSE pipeline depends on the Bioconductor synapter package (Bond et al. 2013) that produces MSnSet instances for indvidual acquisitions. The MSnbase infrastructure can subsequently be used to further combine experiments, as shown in section 13.2 and apply top3 quantitation using the topN method.

Session information

## R version 4.6.0 Patched (2026-05-01 r89994)
## Platform: aarch64-apple-darwin23
## Running under: macOS Tahoe 26.3.1
## 
## Matrix products: default
## BLAS:   /Library/Frameworks/R.framework/Versions/4.6/Resources/lib/libRblas.0.dylib 
## LAPACK: /Library/Frameworks/R.framework/Versions/4.6/Resources/lib/libRlapack.dylib;  LAPACK version 3.12.1
## 
## locale:
## [1] C/en_US.UTF-8/en_US.UTF-8/C/en_US.UTF-8/en_US.UTF-8
## 
## time zone: America/New_York
## tzcode source: internal
## 
## attached base packages:
## [1] grid      stats4    stats     graphics  grDevices utils     datasets 
## [8] methods   base     
## 
## other attached packages:
##  [1] gplots_3.3.0         MsDataHub_1.13.0     msdata_0.53.0       
##  [4] pRoloc_1.53.0        BiocParallel_1.47.0  MLInterfaces_1.93.0 
##  [7] cluster_2.1.8.2      annotate_1.91.0      XML_3.99-0.23       
## [10] AnnotationDbi_1.75.0 IRanges_2.47.1       pRolocdata_1.49.0   
## [13] Rdisop_1.73.0        zoo_1.8-15           MSnbase_2.39.1      
## [16] ProtGenerics_1.45.0  S4Vectors_0.51.2     mzR_2.47.0          
## [19] Rcpp_1.1.1-1.1       Biobase_2.73.1       BiocGenerics_0.59.2 
## [22] generics_0.1.4       ggplot2_4.0.3        BiocStyle_2.41.0    
## 
## loaded via a namespace (and not attached):
##   [1] splines_4.6.0               bitops_1.0-9               
##   [3] filelock_1.0.3              tibble_3.3.1               
##   [5] hardhat_1.4.3               preprocessCore_1.75.0      
##   [7] pROC_1.19.0.1               rpart_4.1.27               
##   [9] lifecycle_1.0.5             httr2_1.2.2                
##  [11] doParallel_1.0.17           globals_0.19.1             
##  [13] lattice_0.22-9              MASS_7.3-65                
##  [15] MultiAssayExperiment_1.39.0 dendextend_1.19.1          
##  [17] magrittr_2.0.5              limma_3.69.0               
##  [19] plotly_4.12.0               sass_0.4.10                
##  [21] rmarkdown_2.31              jquerylib_0.1.4            
##  [23] yaml_2.3.12                 otel_0.2.0                 
##  [25] MsCoreUtils_1.25.4          DBI_1.3.0                  
##  [27] RColorBrewer_1.1-3          lubridate_1.9.5            
##  [29] abind_1.4-8                 GenomicRanges_1.65.0       
##  [31] purrr_1.2.2                 mixtools_2.0.0.1           
##  [33] AnnotationFilter_1.37.0     nnet_7.3-20                
##  [35] rappdirs_0.3.4              ipred_0.9-15               
##  [37] lava_1.9.1                  listenv_0.10.1             
##  [39] parallelly_1.47.0           ncdf4_1.24                 
##  [41] codetools_0.2-20            DelayedArray_0.39.2        
##  [43] tidyselect_1.2.1            Spectra_1.23.0             
##  [45] farver_2.1.2                viridis_0.6.5              
##  [47] matrixStats_1.5.0           BiocFileCache_3.3.0        
##  [49] Seqinfo_1.3.0               jsonlite_2.0.0             
##  [51] caret_7.0-1                 e1071_1.7-17               
##  [53] PTMods_1.1.0                survival_3.8-6             
##  [55] iterators_1.0.14            foreach_1.5.2              
##  [57] segmented_2.2-1             tools_4.6.0                
##  [59] progress_1.2.3              glue_1.8.1                 
##  [61] prodlim_2026.03.11          gridExtra_2.3              
##  [63] SparseArray_1.13.2          mgcv_1.9-4                 
##  [65] xfun_0.57                   MatrixGenerics_1.25.0      
##  [67] dplyr_1.2.1                 withr_3.0.2                
##  [69] BiocManager_1.30.27         fastmap_1.2.0              
##  [71] caTools_1.18.3              digest_0.6.39              
##  [73] timechange_0.4.0            R6_2.6.1                   
##  [75] colorspace_2.1-2            gtools_3.9.5               
##  [77] lpSolve_5.6.23              dichromat_2.0-0.1          
##  [79] biomaRt_2.69.0              RSQLite_3.52.0             
##  [81] tidyr_1.3.2                 hexbin_1.28.5              
##  [83] data.table_1.18.4           recipes_1.3.2              
##  [85] FNN_1.1.4.1                 class_7.3-23               
##  [87] prettyunits_1.2.0           PSMatch_1.17.0             
##  [89] httr_1.4.8                  htmlwidgets_1.6.4          
##  [91] S4Arrays_1.13.0             ModelMetrics_1.2.2.2       
##  [93] pkgconfig_2.0.3             gtable_0.3.6               
##  [95] timeDate_4052.112           blob_1.3.0                 
##  [97] S7_0.2.2                    impute_1.87.0              
##  [99] XVector_0.53.0              htmltools_0.5.9            
## [101] bookdown_0.46               MALDIquant_1.22.3          
## [103] clue_0.3-68                 scales_1.4.0               
## [105] png_0.1-9                   gower_1.0.2                
## [107] knitr_1.51                  MetaboCoreUtils_1.21.1     
## [109] reshape2_1.4.5              coda_0.19-4.1              
## [111] nlme_3.1-169                curl_7.1.0                 
## [113] proxy_0.4-29                cachem_1.1.0               
## [115] stringr_1.6.0               KernSmooth_2.23-26         
## [117] BiocVersion_3.24.0          parallel_4.6.0             
## [119] mzID_1.51.0                 vsn_3.81.0                 
## [121] pillar_1.11.1               vctrs_0.7.3                
## [123] pcaMethods_2.5.0            randomForest_4.7-1.2       
## [125] dbplyr_2.5.2                xtable_1.8-8               
## [127] evaluate_1.0.5              magick_2.9.1               
## [129] tinytex_0.59                mvtnorm_1.3-7              
## [131] cli_3.6.6                   compiler_4.6.0             
## [133] rlang_1.2.0                 crayon_1.5.3               
## [135] future.apply_1.20.2         labeling_0.4.3             
## [137] LaplacesDemon_16.1.8        mclust_6.1.2               
## [139] QFeatures_1.23.1            affy_1.91.0                
## [141] plyr_1.8.9                  fs_2.1.0                   
## [143] stringi_1.8.7               viridisLite_0.4.3          
## [145] Biostrings_2.81.1           lazyeval_0.2.3             
## [147] Matrix_1.7-5                ExperimentHub_3.3.0        
## [149] hms_1.1.4                   bit64_4.8.0                
## [151] future_1.70.0               KEGGREST_1.53.0            
## [153] statmod_1.5.2               AnnotationHub_4.3.0        
## [155] SummarizedExperiment_1.43.0 kernlab_0.9-33             
## [157] igraph_2.3.1                memoise_2.0.1              
## [159] affyio_1.83.0               bslib_0.11.0               
## [161] sampling_2.11               bit_4.6.0

References

Bolstad, B M, R A Irizarry, M Astrand, and T P Speed. 2003. A Comparison of Normalization Methods for High Density Oligonucleotide Array Data Based on Variance and Bias. Bioinformatics 19 (2): 185–93.
Bond, N J, P V Shliaha, K S Lilley, and L Gatto. 2013. “Improving Qualitative and Quantitative Performance for MS\(^E\)-Based Label-Free Proteomics.” J Proteome Res 12 (6): 2340–53. https://doi.org/10.1021/pr300776t.
Foster, Joseph M, Sven Degroeve, Laurent Gatto, et al. 2011. “A Posteriori Quality Control for the Curation and Reuse of Public Proteomics Data.” Proteomics 11 (11): 2182–94. https://doi.org/10.1002/pmic.201000602.
Gatto, Laurent, and Kathryn S Lilley. 2012. MSnbase – an R/Bioconductor Package for Isobaric Tagged Mass Spectrometry Data Visualization, Processing and Quantitation.” Bioinformatics 28 (2): 288–89. https://doi.org/10.1093/bioinformatics/btr645.
Gatto, L, L M Breckels, S Wieczorek, T Burger, and K S Lilley. 2014. “Mass-Spectrometry-Based Spatial Proteomics Data Analysis Using pRoloc and pRolocdata.” Bioinformatics 30 (9): 1322–24. https://doi.org/10.1093/bioinformatics/btu013.
Gentleman, Robert C., Vincent J. Carey, Douglas M. Bates, et al. 2004. “Bioconductor: Open Software Development for Computational Biology and Bioinformatics.” Genome Biol 5 (10): –80. https://doi.org/10.1186/gb-2004-5-10-r80.
Gibb, S, and K Strimmer. 2012. MALDIquant: A Versatile R Package for the Analysis of Mass Spectrometry Data.” Bioinformatics 28 (17): 2270–71. https://doi.org/10.1093/bioinformatics/bts447.
Griffin, N M, J Yu, F Long, et al. 2010. “Label-Free, Normalized Quantification of Complex Mass Spectrometry Data for Proteomic Analysis.” Nat Biotechnol 28 (1): 83–89. https://doi.org/10.1038/nbt.1592.
Huber, Wolfgang, Anja von Heydebreck, Holger Sueltmann, Annemarie Poustka, and Martin Vingron. 2002. “Variance Stabilization Applied to Microarray Data Calibration and to the Quantification of Differential Expression.” Bioinformatics 18 Suppl. 1: S96–104.
Jones, Andrew R., Martin Eisenacher, Gerhard Mayer, et al. 2012. “The mzIdentML Data Standard for Mass Spectrometry-Based Proteomics Results.” Molecular & Cellular Proteomics 11 (7). https://doi.org/10.1074/mcp.M111.014381.
Karp, Natasha A, Wolfgang Huber, Pawel G Sadowski, Philip D Charles, Svenja V Hester, and Kathryn S Lilley. 2010. “Addressing Accuracy and Precision Issues in iTRAQ Quantitation.” Mol. Cell Proteomics 9 (9): 1885–97. https://doi.org/10.1074/mcp.M900628-MCP200.
Lazar, C, L Gatto, M Ferro, C Bruley, and T Burger. 2016. “Accounting for the Multiple Natures of Missing Values in Label-Free Quantitative Proteomics Data Sets to Compare Imputation Strategies.” J Proteome Res 15 (4): 1116–25. https://doi.org/10.1021/acs.jproteome.5b00981.
Martens, Lennart, Matthew Chambers, Marc Sturm, et al. 2010. “mzML - a Community Standard for Mass Spectrometry Data.” Molecular & Cellular Proteomics : MCP, ahead of print. https://doi.org/10.1074/mcp.R110.000133.
Orchard, Sandra, Luisa Montechi-Palazzi, Eric W Deutsch, et al. 2007. “Five Years of Progress in the Standardization of Proteomics Data 4th Annual Spring Workshop of the HUPO-Proteomics Standards Initiative April 23-25, 2007 Ecole Nationale Supérieure (ENS), Lyon, France.” Proteomics 7 (19): 3436–40. https://doi.org/10.1002/pmic.200700658.
Paoletti, A C, T J Parmely, C Tomomori-Sato, et al. 2006. “Quantitative Proteomic Analysis of Distinct Mammalian Mediator Complexes Using Normalized Spectral Abundance Factors.” Proc Natl Acad Sci U S A 103 (50): 18928–33. https://doi.org/10.1073/pnas.0606379103.
Pedrioli, Patrick G A, Jimmy K Eng, Robert Hubley, et al. 2004. “A Common Open Representation of Mass Spectrometry Data and Its Application to Proteomics Research.” Nat. Biotechnol. 22 (11): 1459–66. https://doi.org/10.1038/nbt1031.
R Development Core Team. 2011. R: A Language and Environment for Statistical Computing. R Foundation for Statistical Computing. http://www.R-project.org/.
Tan, Denise J, Heidi Dvinge, Andy Christoforou, Paul Bertone, Alfonso A Martinez, and Kathryn S Lilley. 2009. “Mapping Organelle Proteins and Protein Complexes in Drosophila Melanogaster.” J Proteome Res 8 (6): 2667–78. https://doi.org/10.1021/pr800866n.
Taylor, Chris F, Pierre-Alain Binz, Ruedi Aebersold, et al. 2008. “Guidelines for Reporting the Use of Mass Spectrometry in Proteomics.” Nat. Biotechnol. 26 (8): 860–61. https://doi.org/10.1038/nbt0808-860.
Taylor, Chris F., Norman W. Paton, Kathryn S. Lilley, et al. 2007. “The Minimum Information about a Proteomics Experiment (MIAPE).” Nat Biotechnol 25 (8): 887–93. https://doi.org/10.1038/nbt1329.
Wickham, Hadley. 2009. Ggplot2: Elegant Graphics for Data Analysis. Springer New York. http://had.co.nz/ggplot2/book.